PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00131009001
Common NameGSBRNA2T00131009001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 157aa    MW: 17329.4 Da    PI: 6.5221
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00131009001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like50.74e-1641722556
              G2-like 25 ekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                         +  tPk+i+++mkv+gLt+++vkSHLQkYR++
  GSBRNA2T00131009001 41 DGSTPKQIRDMMKVDGLTNDDVKSHLQKYRMH 72
                         568***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-143875IPR009057Homeodomain-like
SuperFamilySSF466893.58E-73875IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-124072IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MQGPNSEKDM GTSDKVSPEL KCPQISIGDI EDVPTIRLNK DGSTPKQIRD MMKVDGLTND  60
DVKSHLQKYR MHIRKHPLYP AAKTLPSSDQ AVLLDKETQS LISLMRSDSP QSPLVVGRGL  120
FSNNNGHSSE DEEKSDGPSS WKSESNKKRQ ALDLEL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00131009001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325123e-91AC232512.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB065B14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013733371.16e-61PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A078BWL61e-111A0A078BWL6_BRANA; BnaC01g02470D protein
TrEMBLA0A0D3A1K71e-111A0A0D3A1K7_BRAOL; Uncharacterized protein
STRINGBra011720.1-P2e-60(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.25e-46G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]